SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299945|ref|YP_400153.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299945|ref|YP_400153.1|
Domain Number 1 Region: 224-467
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.39e-67
Family Leukotriene A4 hydrolase catalytic domain 0.0015
Further Details:      
 
Domain Number 2 Region: 25-218
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 8.11e-50
Family Leukotriene A4 hydrolase N-terminal domain 0.00058
Further Details:      
 
Domain Number 3 Region: 562-832
Classification Level Classification E-value
Superfamily ARM repeat 1.52e-17
Family PBS lyase HEAT-like repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299945|ref|YP_400153.1|
Sequence length 865
Comment PBS lyase [Synechococcus elongatus PCC 7942]
Sequence
MPQHHRFFSLGFDGGDRPSFELPGAKPHYVPDRPGQVEHIALDLTLDLQQQQVAGTCQIR
LKPVRDGIELLELDAVQQQIEAVNIGRRSARFDYDGEQLRIHLPNATKVGRSLEITIHYR
LDRPQRGLYFIQPDEDYPNKPVQVWTQGEDEDSRYWFPCFDYPGQLATSELKVTVPKPYR
AISNGEAIAVTDHGGQQQFHWRQSEPHPTYLMTLAVGDFAELEDSWDGIPIRYYVEKGRE
DQGLRTMGKTPRMVEFFSRTFGYRYPFVQYAQVCVDDFIFGGMENTACTLLTDRCLLDER
AAIDNRSSETLVAHELAHQWFGDLLVIRHWSHGWIKEGMATYSESLWIDHEYGAEEAAYY
RLQTLRSYLDEDRNRYRRPIVTHVYREAIELYDRHLYEKGACVYHLLRTELGEELFWASI
HRFVQQHAHQTVETVDLLRSIEQTTGRNLLPLFDQYVFRGGHPDFKVSYSWDADAKLAKL
TVQQTQSKDGKDLFDLTVPIAFCQLRGRGRSVETESQVFRLRIHEAEQTFYLPLATKPDF
ISFDVGNHALKTVELDYPLAELRSQVQHDSDPVARIQAAAALAKMGGREAIAALADALHK
DTFWGVRAEIAGQLGSIGLEAAETALIKAVKDSDPRVRRAVFTALGQSRSRDRYRALKSA
VEAGDASYYAEASAITALAQVASQPIAGDRKDKAVIKLLKSVLKERSGWNEVVRSAAVTA
LAQFSDSAEALELIEAQTLRGVPQPLRLAAIRALGPVSAGQTDAAIARVLATLRSLAQED
FFLTQVAVVTSLGRMKTPQALSLLQSLAGMSLDGRVKRLADEAIARVQKQMGPDQSLRQL
REEMDQLRQENQKLQNRLLALESKQ
Download sequence
Identical sequences Q31P53
gi|81299945|ref|YP_400153.1| 1140.Synpcc7942_1136 WP_011377877.1.45845 WP_011377877.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]