SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299960|ref|YP_400168.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299960|ref|YP_400168.1|
Domain Number 1 Region: 7-280
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.69e-98
Family Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) 0.00000148
Further Details:      
 
Domain Number 2 Region: 284-506
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.78e-41
Family Nucleotide and nucleoside kinases 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299960|ref|YP_400168.1|
Sequence length 527
Comment bifunctional pantoate ligase/cytidylate kinase [Synechococcus elongatus PCC 7942]
Sequence
MRQLISPEALRAFRQSVQGSVGFVPTMGALHAGHRSLIERSRQQDDVVIVSIFVNPRQFG
PQEDLSRYPQTLDADLALCEAAGVDAVFCPTAEALYPRPSDRSTGVQPPAELIQSLCGRQ
RPGHFQGVATVVLKLLQLVQPQRAYFGEKDAQQLRVIQRLVEDFNLPIAIVPCPTVREPD
GLALSSRNRYLTFEERSQASGLYRALRAAAECFQAGSRDSQELVAAATAVLATTPAVQLE
YCDCVDADSLQPLTQIPDRALLAIAARVGTARLIDNLTLQGRRPIIAIDGPAGAGKSTVT
KRLAQQLGLLYLDTGAMYRAVTWLVQQQGIDPQDPIVLAELLAQADLQLRSQPAADGSEQ
LQVLIQGNDVTAAIRTPTVTAQVSAIAALPLVRQFLVEQQRQLGQRGGLVAEGRDIGTHV
FPDAELKIFLTATNAERARRRALDLEAQGLTVDLAQLEAEIRDRDRQDSERAIAPLCKAE
DAVEVLTDGLSIEAVTDQIIRLYRDRGLGDSSPQATPGQTPSPLSLG
Download sequence
Identical sequences Q31P38 Q5N530
gi|56750408|ref|YP_171109.1| gi|81299960|ref|YP_400168.1| WP_011242711.1.45845 WP_011242711.1.5740 WP_011242711.1.95485 1140.Synpcc7942_1151 269084.syc0399_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]