SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300049|ref|YP_400257.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300049|ref|YP_400257.1|
Domain Number 1 Region: 134-306
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.74e-43
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000947
Further Details:      
 
Domain Number 2 Region: 390-506
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.37e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00002
Further Details:      
 
Domain Number 3 Region: 16-133
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.94e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.00016
Further Details:      
 
Domain Number 4 Region: 303-376
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.54e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300049|ref|YP_400257.1|
Sequence length 512
Comment ferredoxin-nitrite reductase [Synechococcus elongatus PCC 7942]
Sequence
MAQATATTEKLNKFEKLKLEKDGLAVRDQIQHFASIGWEAMDPGDREHRLKWLGIFWRPV
TPGRFMARLRIPSGILQSQQLNALANFLQRYGDQASIDITTRQNLQLRGLLLEDTPEFLE
RLHAVGLTSVQSGMDNVRNITGSPVAGLDAAELFDTRSLIQALQDDLTAAGQGNSEFTNL
PRKFNIAIEGGRDNSIHAEINDLAFTPAYQDGTLGFNVWVGGFFSSTRVAPAIPLNAWVP
ADHSVIRLSRAILEVFRDNGSRGNRQKTRLMWLIDEWGIERFRQVVSEAYGAPLAAAAPE
LMDWEKRDFLGVHPQKQAGLNFVGLHVPVGRLTTEDLYELARLADTYGQGEVRLTVEQNV
ILTHIPDAQLPTLLAEPLLTRFSPQPAPLSRGTVSCTGSQYCNFALIETKQRAIAIAQSL
EAELDLPRPVRIHWTGCPNSCGQPQVADIGLMGAKVRKDGQMVEGVDIFLGGKVGYDAHL
GEKAMTGVACEDLPDVLRQLLIERFGAQARSH
Download sequence
Identical sequences A0A0H3JZV0 P39661
gi|81300049|ref|YP_400257.1| gi|56750319|ref|YP_171020.1| 1140.Synpcc7942_1240 269084.syc0310_d WP_011242624.1.45845 WP_011242624.1.5740 WP_011242624.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]