SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300090|ref|YP_400298.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300090|ref|YP_400298.1|
Domain Number 1 Region: 165-214
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000248
Family GSPII protein E N-terminal domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 101-157
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000549
Family GSPII protein E N-terminal domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300090|ref|YP_400298.1|
Sequence length 230
Comment hypothetical protein Synpcc7942_1281 [Synechococcus elongatus PCC 7942]
Sequence
MRFHLRSRSGEEIVLYLRPGNPSAPIEMAGPANLCGTVSTLLKMSLTGLSATSDDLLSLC
EYDPVFRHWFRLDAVVKDGDPEPAHREDAKFAAMEPIYPSQVAAMRLGERLTAASLVTKE
QLDEALKGIQEQMPHLQIGEILCGRGYLSHRTMEFFLDPITKMNTAFLTLRLGERLQAAG
VVNDRDVHRALQCQQWLPLSLGRLLVLNGAVSQATADFFGRLSIEPSSLS
Download sequence
Identical sequences Q31NQ8
1140.Synpcc7942_1281 gi|81300090|ref|YP_400298.1| WP_011377955.1.45845 WP_011377955.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]