SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300111|ref|YP_400319.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300111|ref|YP_400319.1|
Domain Number 1 Region: 3-155
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.02e-34
Family Universal stress protein-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81300111|ref|YP_400319.1|
Sequence length 158
Comment hypothetical protein Synpcc7942_1302 [Synechococcus elongatus PCC 7942]
Sequence
MSYQKILAAIDLSAGKSSIFKKALTLAQQNQAQLVLLHCSPLPPVYSSSYINFLNSPSDW
TVDLSLAEASQRQDAELARQQLQDLRQQATAVNIEAIPLLRFIDPSRGICDAVKDLGVDL
VVVGRRGLSGISEILMGSVSSYVVHHVSCDVLIVQADQ
Download sequence
Identical sequences Q31NN7
gi|81300111|ref|YP_400319.1| WP_011377971.1.45845 WP_011377971.1.5740 WP_011377971.1.95485 1140.Synpcc7942_1302 2005296541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]