SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300123|ref|YP_400331.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300123|ref|YP_400331.1|
Domain Number 1 Region: 166-434
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.77e-70
Family Extended AAA-ATPase domain 0.0000000615
Further Details:      
 
Domain Number 2 Region: 421-618
Classification Level Classification E-value
Superfamily FtsH protease domain-like 9.29e-67
Family FtsH protease domain-like 0.00000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300123|ref|YP_400331.1|
Sequence length 623
Comment FtsH-2 peptidase [Synechococcus elongatus PCC 7942]
Sequence
MAIKENPTRPSRNRIISFVLFGVGLFFLLIGLIPGVGSPQVSRVPYSLFIDQVNDGLVAR
AYITQEQIRYQLKDVEGEAGDVLSTTPIFDLELPQRLEQKGVEFAAAPPQKGNFFTTLLG
WIIPPLIFIGVLQFFAARQARNGPQGALSFTKSRAKVYVEGDDTRTTFSDVAGVEEAKAE
LQEIVDFLKTPERYLNIGARIPKGVLLVGPPGTGKTLLAKAVAGEARVPFFSISGSEFVE
LFVGAGAARVRDLFEQAKQKAPCIVFIDELDAIGKSRASGNFMGGNDEREQTLNQLLTEM
DGFSADGATVIVLAATNRPETLDPALLRPGRFDRQVLVDRPDLAGRKAILDIYGRKVKLD
PEVDLQAIAVRTSGFAGADLANLINEAALLAARNGRTEVAQADLNEAIERVVAGLEKKSR
VLNDNEKRIVAYHEVGHAIVGALMPGGSKVAKISIVPRGMAALGYTLQLPTEDRFLLSAE
ELKGQIATLLGGRSAEEIIFGSITTGASNDLQRATDVAEQMVTTYGMSQVLGPLAFDKGG
GNNFLGGEGMNPRRRVSDETAKAIDAEVKQLVDDGHDQALAILNRNRDLLEEIAQRILDV
EVIEGDELQSLLQRAELPELQPA
Download sequence
Identical sequences Q31NM5
gi|81300123|ref|YP_400331.1| WP_011377979.1.45845 WP_011377979.1.5740 WP_011377979.1.95485 1140.Synpcc7942_1314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]