SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300132|ref|YP_400340.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300132|ref|YP_400340.1|
Domain Number 1 Region: 2-145
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 7.85e-35
Family N-terminal domain of MutM-like DNA repair proteins 0.00054
Further Details:      
 
Domain Number 2 Region: 139-229
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.66e-31
Family Middle domain of MutM-like DNA repair proteins 0.0011
Further Details:      
 
Domain Number 3 Region: 229-280
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.68e-17
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300132|ref|YP_400340.1|
Sequence length 282
Comment formamidopyrimidine-DNA glycosylase [Synechococcus elongatus PCC 7942]
Sequence
MPELPEVETVRRGLTQQTLQRVCTGGEVLLSRTIATPTPELFLVALQQTQIQEWRRRGKY
LLADLSREGEPAGTWGVHLRMTGQFFWTEPATPLTKHTRVRLRFEGDRELRFIDIRSFGQ
MWWVPPDRPVESVITGLSKLGPEPFAPEFTARYLRDRLRRSQRPIKTALLDQSLVAGIGN
IYADESLFRTGIHPTTPSDRLTKIQAEKLREAIVEVLTASIGAGGTTFSDFRDLTGVNGN
YGGQAWVYGRKDQPCRTCGTPIQKLKLAGRSSHFCPRCQPCS
Download sequence
Identical sequences Q08079 Q31NL6
1140.Synpcc7942_1323 gi|81300132|ref|YP_400340.1| WP_011377983.1.45845 WP_011377983.1.5740 WP_011377983.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]