SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300188|ref|YP_400396.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300188|ref|YP_400396.1|
Domain Number 1 Region: 84-353
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.95e-75
Family BC ATP-binding domain-like 0.00000138
Further Details:      
 
Domain Number 2 Region: 2-114
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.6e-48
Family BC N-terminal domain-like 0.000015
Further Details:      
 
Domain Number 3 Region: 332-445
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 5.23e-45
Family BC C-terminal domain-like 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300188|ref|YP_400396.1|
Sequence length 453
Comment acetyl-CoA carboxylase biotin carboxylase subunit [Synechococcus elongatus PCC 7942]
Sequence
MRFNKILIANRGEIALRILRTCEELGIGTIAVHSTVDRNALHVQLADEAVCIGEAASSKS
YLNIPNIIAAALTRNASAIHPGYGFLAENARFAEICADHHLTFIGPSPDSIRAMGDKSTA
KETMQRVGVPTIPGSDGLLTDVDSAAKVAAEIGYPVMIKATAGGGGRGMRLVREPADLEK
LFLAAQGEAEAAFGNPGLYLEKFIDRPRHVEFQILADAYGNVVHLGERDCSIQRRHQKLL
EEAPSPALSADLRQKMGDAAVKVAQAIGYIGAGTVEFLVDATGNFYFMEMNTRIQVEHPV
TEMITGLDLIAEQIRIAQGEALRFRQADIQLRGHAIECRINAEDPEYNFRPNPGRITGYL
PPGGPGVRVDSHVYTDYEIPPYYDSLIGKLIVWGATREEAIARMQRALRECAITGLPTTL
SFHQLMLQMPEFLRGELYTNFVEQVMLPRILKS
Download sequence
Identical sequences A0A0H3K2J9 Q54755
gi|56750186|ref|YP_170887.1| WP_011242491.1.45845 WP_011242491.1.5740 WP_011242491.1.95485 1140.Synpcc7942_1379 269084.syc0177_c gi|81300188|ref|YP_400396.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]