SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300206|ref|YP_400414.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300206|ref|YP_400414.1|
Domain Number 1 Region: 55-239
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000000000477
Family Apolipoprotein A-I 0.0084
Further Details:      
 
Weak hits

Sequence:  gi|81300206|ref|YP_400414.1|
Domain Number - Region: 248-370
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000484
Family Apolipoprotein 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300206|ref|YP_400414.1|
Sequence length 442
Comment hypothetical protein Synpcc7942_1397 [Synechococcus elongatus PCC 7942]
Sequence
MSNDKTPNSPESTPSTPADEVLDGLLAELSPEASAEPNPADDSGNPFTTIFKSVTDKATE
LGSAATEGLSNLQESATELAAETKEKFGNFAEAHKDDLGQLLTSAQGKAASFGEAVSDRF
GELGESATESFGNLQEGAAGFAAGAKEKFGDFAEASQEKLSEIAETTQDKAASFGEAVSD
RVEGLRGSAAEKLGNLQEGASELAAGAKEKFGDFAEASQEKLSEIVETTQGKAASFGEAV
SDRVEGLRGSAAEKLGNLQEGASELAAGAKEKFGDFAEASQEKLSEIVETTQGKAASFGE
AVSDRFGELGESAAEKLSNLQEDASEFAASAQEKLSTFTNARQEELGNLTKSAQSDVQDT
ANTVSEQLEQAPEAVSTAADSLKGAQEKLEAAVVASQSVAEKLKPAEVQSQSSLQLASES
PSPSFFGRLLRKIKGFFRKLFG
Download sequence
Identical sequences Q31NE2
gi|81300206|ref|YP_400414.1| 1140.Synpcc7942_1397 SnR147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]