SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300237|ref|YP_400445.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300237|ref|YP_400445.1|
Domain Number 1 Region: 108-305
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.72e-59
Family BC ATP-binding domain-like 0.00045
Further Details:      
 
Domain Number 2 Region: 9-104
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.45e-25
Family BC N-terminal domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 310-382
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.0000000000000487
Family BC C-terminal domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81300237|ref|YP_400445.1|
Sequence length 395
Comment phosphoribosylaminoimidazole carboxylase ATPase subunit [Synechococcus elongatus PCC 7942]
Sequence
MNAIAVSPVQHVGVIGGGQLAWMLAPAAQQLGMSLHVQTPNDHDPAVAIADQTVLAAVAD
AAATAKLAQACDVITFENEFVDLPALTELEETGVRFRPRPAAIASLLDKLDQRQLLTRLG
LPTPRFLAIAAATATESELTALGFPVVLKQRRHGYDGKGTQVLRSLAELQQALQSYGDTP
LLLEEFIPFEQELAVMVARSQSGAIATFPVVQTHQQNQVCRWVVAPAAIPGALQKAVAAI
ARTLVETVDYVGVAGIELFQQGDRLWVNEIAPRTHNSGHYSLDACQTSQFEQQLRAIADL
PLGSTALQWPGALMVNLLGFEDHQSGYAELRQQLAALPGACLYWYGKTESKPGRKLGHIT
LPLSGASSTERAQQAQTMLAQVEAIWPNPDTAHQP
Download sequence
Identical sequences A0A0H3JZ24 Q54975
WP_011242442.1.45845 WP_011242442.1.5740 WP_011242442.1.95485 gi|56750137|ref|YP_170838.1| 1140.Synpcc7942_1428 269084.syc0128_c gi|81300237|ref|YP_400445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]