SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300261|ref|YP_400469.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300261|ref|YP_400469.1|
Domain Number 1 Region: 70-285
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.58e-45
Family RecA protein-like (ATPase-domain) 0.02
Further Details:      
 
Domain Number 2 Region: 270-284,318-468
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.16e-35
Family ATP-dependent protease Lon (La), catalytic domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|81300261|ref|YP_400469.1|
Domain Number - Region: 7-32
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0722
Family Rubredoxin 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300261|ref|YP_400469.1|
Sequence length 478
Comment DNA repair protein RadA [Synechococcus elongatus PCC 7942]
Sequence
MARSRSEYVCQNCGHRAPRYVGRCPACESWNSLVEEAIAPTAKTAIATVLPSRQRRDRLA
EAPPQAVAAQPLSAIADVSQQRIASGSGEFDRVLGGGLVPGSLVLIGGDPGIGKSTLLLQ
TATALSQQQPILYVCAEESGQQVKLRWQRIAAHRSPNQADQQFYLLPEIDLDAIVAELET
LRPPVAIIDSIQALYSPALGSAPGSVAQVRECTAALMRVAKQLTITLLIVGHVTKDGAIA
GPKVLEHLVDTVLYFEGDRFASHRLLRSVKNRFGASQELGIFEMVDRGLEEVGNPSALFL
GSRDQATSGTATIVACEGTRPLLVELQALVSPSSYSSPRRAGTGIEYNRLLQILAVLEKR
LGLPLSKFDAYVASAGGLNVAEPAADLGIAIALVASFRDRCLRPDTVLIGEIGLGGQVRP
VSQVELRLKEAAKLGFQRALLPKGQERCESDLELVPVSRLVDAIGLALQEAPPSSDRS
Download sequence
Identical sequences Q31N87
1140.Synpcc7942_1452 gi|81300261|ref|YP_400469.1| WP_011378038.1.45845 WP_011378038.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]