SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300355|ref|YP_400563.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300355|ref|YP_400563.1|
Domain Number 1 Region: 3-312
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.17e-52
Family RNB domain-like 0.0024
Further Details:      
 
Weak hits

Sequence:  gi|81300355|ref|YP_400563.1|
Domain Number - Region: 392-459
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000425
Family Double-stranded RNA-binding domain (dsRBD) 0.019
Further Details:      
 
Domain Number - Region: 327-400
Classification Level Classification E-value
Superfamily FliG 0.0392
Family FliG 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81300355|ref|YP_400563.1|
Sequence length 465
Comment ribonuclease II [Synechococcus elongatus PCC 7942]
Sequence
MQTVLTIDGPSSLDLDDGVWAEPVDEQGDRICLTIAIAGVATALPHLGIEECVALARLQS
VYQGTQMVRAMLSPERTEALSLLPGGPRPVVCLQALISRRGEVLFSEFWETEVESVAKLS
YEQVNGVLAGKEDHELREVLRWLAIAAGRLDKNRRGLWGRSRQGEFRDDLGSVITGKAEQ
LIASTAIFYNQMAGEKLKQSGFPALFRVQDPRQDEAIAPLFEEHGGNPTVLAPLISHCLP
RAQHRVKAGLHWALQLPAYARSSSPLRRYEDLVNQRQLLAILRESPSFYPPELLLGVCDR
LQDKATAEVERQKQKSEEKWLRAASSVKQLETVTEGQFSAVLRQVSVIGSVPPELEQQLR
ERLEKGSLTPKHAAQILSEGFPADLKQGLIDKLSQGDPLLNGLMVLNTLGQLIGTAPQFD
YEPAEGQWCCRLVWQEQQVEAIASSKVRARELAALMVLKGISVAE
Download sequence
Identical sequences A0A0H3K241 Q31MZ3
gi|56750014|ref|YP_170715.1| 1140.Synpcc7942_1546 269084.syc0005_d WP_011242318.1.45845 WP_011242318.1.5740 WP_011242318.1.95485 gi|81300355|ref|YP_400563.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]