SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300416|ref|YP_400624.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|81300416|ref|YP_400624.1|
Domain Number - Region: 384-494
Classification Level Classification E-value
Superfamily Autotransporter 0.000144
Family Autotransporter 0.026
Further Details:      
 
Domain Number - Region: 80-140
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.00628
Family NadC N-terminal domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81300416|ref|YP_400624.1|
Sequence length 518
Comment porin; major outer membrane protein [Synechococcus elongatus PCC 7942]
Sequence
MNFFVKAGLVVTGANLLAIAPGQALSLDQLQKIDAVTPDGITSGQITSVNELSDVKPTDW
AYQALQSLVERYGCIVGYPDRTFRGARPLSRYEFAAGLNACLDKVIEFAASKEDLDTLKR
LTEEFQAELATLRGRVDALEARTKELEATRFSSTTKLRGEVIFGLDALANSNGNEVNSNG
AVSFGNKVDLDLDTSFTGKDLLKTRLRARNIEPITNRLAPGFRAPGSVLDYGGNSNNTFF
IDKLYYTFPAGSVRFTVGTVGVGVQEYGMRDATFSSGANEGKTFRKGPANIYESNGKAGV
GFDWRINPNFSFQLGYLNRGADQVGVDQGGFFGQGTVGTAKSGWDVATQLRFETDNRKFR
AALAYSLRNDRYVTDLGTTRAERPFGAANYNTNNLALTMGWAVSDNFTISGAYGIGFANV
AGGSDSATIQTWNVGLTFPDLFAKGNSGVITVGQMPYVTSASQQSAEDTGSLGLEVNYKF
QVTDNISITPGIYLFNNTNGLENGGTSYVPYLRTIFRF
Download sequence
Identical sequences Q9KHA8
1140.Synpcc7942_1607 gi|81300416|ref|YP_400624.1| WP_011378110.1.45845 WP_011378110.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]