SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300418|ref|YP_400626.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300418|ref|YP_400626.1|
Domain Number 1 Region: 2-358,393-411
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 8.85e-115
Family B12-dependent (class II) ribonucleotide reductase 0.00018
Further Details:      
 
Domain Number 2 Region: 780-1131
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 4.27e-109
Family B12-dependent (class II) ribonucleotide reductase 0.00035
Further Details:      
 
Domain Number 3 Region: 409-534,707-779
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 9.61e-44
Family Intein (protein splicing domain) 0.0075
Further Details:      
 
Domain Number 4 Region: 609-732
Classification Level Classification E-value
Superfamily Homing endonucleases 1.93e-16
Family Intein endonuclease 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300418|ref|YP_400626.1|
Sequence length 1137
Comment protein splicing (intein) site [Synechococcus elongatus PCC 7942]
Sequence
MVQELSRVLKISDFPATAPAANPVFYRTYSRKTATGRESWQEVSDRTIQGLAELGKLTQA
EVELLQRYQEKQQSLPSGRWLWVGGTDWIAKPENYNGGYNCTSTNVIDWRAFGLMMDLAM
MGCGTGAILEPKYINQLPAIRNELQVSIVGALGQTPAEERQEQTRVAIEGNSVTIRVGDS
RAGWVKSYQTLLELSSDDRFTGPVQVAIDLSDVRPAGERLKGFGGVANPVKLPELYDRVA
QILNKAVGRQLDSIECCLLIDQAAVVVVAGNVRRSAGMRQFDSGDLRAAGAKENLWQQDE
AGNWRIDPERDALRMANHTRVYHHKPTREEVLEAVTKQFYSGEGAIQYAPEAIARSNADL
LTTPELRQEFIQIYLELGAEEAKNWLKTNWPNQSDRELNHRLQRYGLNPCVTADTWVHTG
EGPRQVKDLIGQQHSTYINGELFSTTPDGFFCSGIKPVLKIQTQEGYSLRLTANHRVLKV
TAQTQKAQYSEWVEAGDLQAGDRILLHNHRGLQAWEGVGTEAEGWLLGNFIGDGCFSVNE
ANYQRQGLLRFWGETQAEMAEKALALGKVASVTTAAHAAVVHPRNGYSQINSAKLYQLAT
SFGLKQGLKTITPAIEQASYAFYQGFLRGLFDADGSVQGSQEKGVSVRLAQSDLGLLEAV
QRMLLRLGIASTIYQERRPAGERLLPDSQRQPKAYFCKAQHELAIANDNLQIFAELIGFL
DEAKQEKLTELLGAYKRQPNRERFTATVVSLEADGVETVYDCTVPGPARFDANGLVAHNC
GEILGADFHCNLAEVHLNQIDPQDTKTQEDAFRAGAISVAALLNHQFSEERYQFSREVDP
IVGVSFTGLFDFFVHAFGTPWLEWWTEGRPETEQGLEFKRQEAAYLNRWRDVVHAAVWDY
CDRHDLRRPNRCTTVQPAGTKSLLTGASPGWHPPKAQRFLRRITFRKNDPVAMACLDYGY
SIVPSQSDKDENGNLLNDPFDPRCTEWLVEIPTEVSWANLPGADQVDISQFSALAQFDFY
MQVQTHYTTHNTSATIEFREPEIQPLADRIYEAIANNQGYMSAALLARFDANATFPRLPF
EPIDKATYERLEAEVVQRRRTDDFLAALRLYDSGFQVEAGPAGCDSDKCMMPEQKPN
Download sequence
Identical sequences Q31MT0
gi|81300418|ref|YP_400626.1| 1140.Synpcc7942_1609 WP_011378112.1.45845 WP_011378112.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]