SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300419|ref|YP_400627.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300419|ref|YP_400627.1|
Domain Number 1 Region: 296-468
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.67e-72
Family Transhydrogenase domain III (dIII) 0.0000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300419|ref|YP_400627.1|
Sequence length 470
Comment pyridine nucleotide transhydrogenase subunit beta [Synechococcus elongatus PCC 7942]
Sequence
MREIWVQSSYLAATIFFFLGLKQLGHPATARRGNYLGAAGMGLAVLGTAFHPDLQDPWLP
LLAVGLGSIAGIVSAQRVVMTAMPQMVALLNGLGGAASALVAIAEYLRLSQVPLAATQQL
PTLIALLLGLLIGGVTLSGSLVAFAKLQGLISGQPLTLPSHRLWSLLLLLGFVSGAVLFL
VAPQAPTALAVLTALAIATLLLGLFFVAPVGGGDMPVVIALLNSLSGLAASAAGFAVNNN
LLIIAGALVGASGLILTVIMCKAMNRSLTNVLFSGLVAAGGQADGGTSAAGDRNARQIDS
DEGAMLLGYARSVVIVPGYGMAVAQAQHTVRELAEHLQRLGVEVKYAIHPVAGRMPGHMN
VLLAEANVPYGQLYDLESINSEFEHTDVALVIGANDVVNPAARLDNSSPIYGMPILDVDR
ARQTIVIKRSMANGYAGIDNPLFYGDRTVMLFGSAREVISQLVGAVKELS
Download sequence
Identical sequences Q31MS9
1140.Synpcc7942_1610 WP_011378113.1.45845 WP_011378113.1.95485 gi|81300419|ref|YP_400627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]