SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300437|ref|YP_400645.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300437|ref|YP_400645.1|
Domain Number 1 Region: 10-185
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0000000000863
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300437|ref|YP_400645.1|
Sequence length 239
Comment hypothetical protein Synpcc7942_1628 [Synechococcus elongatus PCC 7942]
Sequence
MKSAKTSRFNQPFLLRILHGVTGVSLIAAILTAYWTYDTYDGRWGRIPLPQFPEIEGIHG
TFGLWTLLIFPVFLIYAVHRGQKRLVQANSLQQLAHIGHPSWWYTLNRWINTVTLALLTF
ALFSGKMMDEKWLPNGELQHSWYLAHLLSWLLMVGAIALHLVVNFKVGGALFLLSMWRWR
HHRSESPYFWPSSIAQGWAAIQQGTWICWFQPLSGLMMMELSILISLAVAWILPYFKAD
Download sequence
Identical sequences A0A0H3K566 Q31MR1
WP_011242400.1.45845 WP_011242400.1.5740 WP_011242400.1.95485 1140.Synpcc7942_1628 269084.syc0087_d gi|56750096|ref|YP_170797.1| gi|81300437|ref|YP_400645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]