SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300471|ref|YP_400679.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300471|ref|YP_400679.1|
Domain Number 1 Region: 4-319
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 8.31e-99
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000045
Further Details:      
 
Domain Number 2 Region: 340-475
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 4.32e-30
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300471|ref|YP_400679.1|
Sequence length 478
Comment cysteinyl-tRNA synthetase [Synechococcus elongatus PCC 7942]
Sequence
MTLSLYNTLTRQKQRFEPLQAGSVSLYCCGVTVYDYCHLGHARSYIVWDTLRRYLLWLGY
RVRYVQNFTDIDDKILRRSRQEGTTMQAIADRYTQAYFEDMARLNILEADDYPRATHTLD
GIQRLIAELEDKGFAYAADGDVYFSVRRFQDYGKLSGRKLEDLKAGASGRVESAEESLKH
DPFDFALWKAAKPEEPAWDSPWGPGRPGWHIECSAMVRDRLGDSIDIHVGGADLVFPHHE
NEIAQSEAVTGHPLARYWLHNGMVNVGGEKMSKSLGNFTTIRQLLDEGGISPMVLRLFVL
QANYRKPIDFTDEALQACQNGWETLQEGLHFGEHWGDRLGWTESVTVDPDLSDRFRMAMD
DDLNTPAALAVLFELAKELRRQQNLLIHEGHLDGDAQQLHQHWVTLVQLAGVLGLEAEPE
LAETNELDEAAIEDWIAKRHAARQAKDFAEADRIRHYLADLGITLIDQAGGITRWSRT
Download sequence
Identical sequences Q31MM7 Q5MZA4
gi|56752435|ref|YP_173136.1| WP_011244736.1.45845 WP_011244736.1.5740 WP_011244736.1.95485 1140.Synpcc7942_1662 269084.syc2426_d gi|81300471|ref|YP_400679.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]