SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300521|ref|YP_400729.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300521|ref|YP_400729.1|
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily ssDNA-binding transcriptional regulator domain 4.71e-44
Family PMN2A0962/syc2379c-like 0.000000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81300521|ref|YP_400729.1|
Sequence length 121
Comment hypothetical protein Synpcc7942_1712 [Synechococcus elongatus PCC 7942]
Sequence
MGRILREGAGWRLGWDETAHRYPGLVGTTDWAVELTAAEMADFCRLVQQLAETIAAIAPE
LMPEERLQIEAESALLWLEAEGFADAYELRLILASDRRVEACWPAAAVPALVAATHTLKG
F
Download sequence
Identical sequences A0A0H3K9B1 Q31MH7
000005792|e2nvnA1|295.1.1.1|A:2-122 d2nvna1 WP_011244689.1.45845 WP_011244689.1.5740 WP_011244689.1.95485 gi|56752388|ref|YP_173089.1| 1140.Synpcc7942_1712 269084.syc2379_c gi|81300521|ref|YP_400729.1| 368396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]