SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300660|ref|YP_400868.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300660|ref|YP_400868.1|
Domain Number 1 Region: 92-256
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.79e-19
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 350-470
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.66e-18
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0019
Further Details:      
 
Domain Number 3 Region: 265-343
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0000000000000163
Family Duplicated SiR/NiR-like domains 1 and 3 0.0041
Further Details:      
 
Domain Number 4 Region: 5-84
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.000000000000018
Family Duplicated SiR/NiR-like domains 1 and 3 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81300660|ref|YP_400868.1|
Sequence length 487
Comment ferredoxin--nitrite reductase [Synechococcus elongatus PCC 7942]
Sequence
MSWLTQANACPGVFYGTRAQDGFLLRIRIPAGTLHLNQLKVIANLLTTLQCDQVQVTNRA
NLQIRGVQRAIDSSELNQLQAVGLAATHPQTDHLRNLMASPTAGIDPEELLDTRPYIQQI
DQFLQQHPEYGELSAKFSIGLDGGGSVGIGTRSPVAWEHRLNDVQLTAIQTNQQEIPFLL
QLAVKKQLIDTGYIITPDQLLPTIATLTAIYYEYSNQEVKAGRQGKPRLHSLIESWGLEQ
FLQVIQERSRQSLETTQQSLPVSQPYRQFGFYPQSNPDLFYLGIRSFLGQITGLQLTALI
QILEALNCQEIRLTPWQSLIVPNLNKSEVIEAQQRFQELGFATTAKEPVIIACAGHPVCQ
AAIVPTQPLAERLQQAIDQVCQALDPINIHISACSKFCAQSSPAEITILAADSPEEQKPN
ERYNIFFGDSDRFDRISGPSLSFHQVISFITEVLKRYQKHRQSTSESLVQFLLRSQFDLN
TIVPVLL
Download sequence
Identical sequences A0A0H3K595 Q31M38
WP_011244553.1.45845 WP_011244553.1.5740 WP_011244553.1.95485 gi|81300660|ref|YP_400868.1| gi|56752252|ref|YP_172953.1| 1140.Synpcc7942_1851 269084.syc2243_c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]