SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300852|ref|YP_401060.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300852|ref|YP_401060.1|
Domain Number 1 Region: 17-125
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 3.45e-42
Family Bacterial S-adenosylmethionine decarboxylase 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81300852|ref|YP_401060.1|
Sequence length 139
Comment S-adenosylmethionine decarboxylase proenzyme [Synechococcus elongatus PCC 7942]
Sequence
MTVSLNPLLADPPALGVGRHCILEIYGCAGELLNDAAYVDRSIREAAIAAGATLLNQVCH
EFEPQGVTALALLAESHISIHTWPENGYAAVDVFTCGDHTQPEVACHHLIQAFKAEHHSL
HSIVRRPPAAIREHERVPA
Download sequence
Identical sequences A0A0H3K817 Q31LJ6
gi|56752059|ref|YP_172760.1| gi|81300852|ref|YP_401060.1| WP_011244360.1.45845 WP_011244360.1.5740 WP_011244360.1.95485 1140.Synpcc7942_2043 269084.syc2050_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]