SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300869|ref|YP_401077.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300869|ref|YP_401077.1|
Domain Number 1 Region: 2-217
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.96e-69
Family "Hypothetical" protein ybl036c 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81300869|ref|YP_401077.1|
Sequence length 221
Comment hypothetical protein Synpcc7942_2060 [Synechococcus elongatus PCC 7942]
Sequence
MAQIAERLASLRSQLPPSVQLIAVSKNHPAAAIREAYAAGQRHFGENRVQEAIAKQAELT
DLPDLTWHLLGKLQSNKARKAVEHFDWIHSVDSWALAERLDRIAGELGRSPKLCLQVKLL
PDPNKAGWDPADLRAELPQLSQLQQVQIRGLMVIAPLGLTAAETQALFAQARTFAAELQQ
QAPQLRLTELSMGMSSDWPLAVAEGATWIRVGTQLFGPRSL
Download sequence
Identical sequences A0A0H3K4N9 Q31LH9
NYSGRC-FDAO-ABB58090 WP_011244343.1.45845 WP_011244343.1.5740 WP_011244343.1.95485 1140.Synpcc7942_2060 269084.syc2033_d gi|81300869|ref|YP_401077.1| gi|56752042|ref|YP_172743.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]