SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300928|ref|YP_401136.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300928|ref|YP_401136.1|
Domain Number 1 Region: 307-494
Classification Level Classification E-value
Superfamily alpha/beta knot 1.64e-48
Family SpoU-like RNA 2'-O ribose methyltransferase 0.0000165
Further Details:      
 
Domain Number 2 Region: 238-316
Classification Level Classification E-value
Superfamily L30e-like 9.77e-18
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300928|ref|YP_401136.1|
Sequence length 519
Comment RNA methyltransferase TrmH, group 3 [Synechococcus elongatus PCC 7942]
Sequence
MSDYSDRSDFSERQDRSSDDRPNFRRFDRDRPSEGRRFEGRSEGGYRGRDDRGGSGGYRQ
NRDDRGGFRGRDDRGGYRGGDRDRPSEGRRFEGRSEGGYRGRDDRGGSGGYRQNRDDRGG
FRGRDDRGGYRGGDRDRPSEGRRFEGRSEGGFRGRDDRGGSGGYRGRDDRGGFRGRDDRG
GFRGRDDRGSSGSYRGRDDRGGFRGRDDRRDDRDNFRPSRDRELNREVNTSPAGDQEATD
HELIYGRHAVLAALQGNRTLNRIWVTPRLRYESTFLELIDAAKAGGAVVDEVPVERIRQL
TDGAVHQGIAAQVAPYPYQELSDLIAQAKAATTDPVIVVADGITDPHNLGAIIRTAEALG
AHGLVIPQRRAVGVTAAVAKVAAGALESFPVARVVNLNRALEELKDAGFWIYGAAGEAKQ
SIHETSFSGPVVLVVGSEDEGLSLLTRERCDHLISIPLRGKTNSLNASVAAGMVLYEVSR
QRQQLTHHLEGIADNGATALTTAAVEFAGAAAGLGELGL
Download sequence
Identical sequences Q31LC0
WP_011378325.1.45845 WP_011378325.1.95485 1140.Synpcc7942_2119 gi|81300928|ref|YP_401136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]