SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81300967|ref|YP_401175.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300967|ref|YP_401175.1|
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Globin-like 2.51e-53
Family Phycocyanin-like phycobilisome proteins 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300967|ref|YP_401175.1|
Sequence length 169
Comment allophycocyanin subunit beta [Synechococcus elongatus PCC 7942]
Sequence
MRDAVSSLIAGYDLAGKYLDRNAVDSLRAYFAEGNARVQAAEIINANAASLVRDASAQLF
EEVPELLRPGGNAYTTRRYSACLRDLDYYLRYATYALVAGNTEVLDERVLQGLRETYTSL
GVPSGPTVRGIAILRDRVRQLVEQAGISNAAFVEVPFDHLGRNLAEQDI
Download sequence
Identical sequences A0A0H3K7N0 O50209
gi|81300967|ref|YP_401175.1| 2005138954 WP_011244246.1.45845 WP_011244246.1.5740 WP_011244246.1.95485 1140.Synpcc7942_2158 269084.syc1936_c gi|56751945|ref|YP_172646.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]