SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81301008|ref|YP_401216.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301008|ref|YP_401216.1|
Domain Number 1 Region: 4-258
Classification Level Classification E-value
Superfamily PHP domain-like 1.92e-34
Family PHP domain 0.0063
Further Details:      
 
Domain Number 2 Region: 758-843
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.00000000000000141
Family Intein (protein splicing domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81301008|ref|YP_401216.1|
Sequence length 870
Comment DNA polymerase III subunit alpha [Synechococcus elongatus PCC 7942]
Sequence
MSFVGLHMHSDYSLLDGASQLPDLVARAKELGMPAIALTDHGVMYGAIELLKVCKNQGNI
RPIIGNEMYVINSPIDDPNPRVRKYHQIVLAKNKKGYQNLVKLTSISHLQGFKGRGIFAR
PCIDKEHLEKYREGLIVTSACLGGEIPQAILQSRPDVARRVAAWYQERFGEDFYLEIQDH
GSPEDRIVNVEIVRIAQELGIELVATNDSHFISCFDVEAHDALLCIQTGKLVVEDKRLRY
SGTEYLKSAEEMHQLFRDHLPDDVIAKAIANTLVIASKIEDYNILGEPKIPTFPVPDGYN
EETYMAEVARQGLAERLNCDRYEDCEEAYRDRLEYEIKMMHEMGFASYFLVVWDYIKFAR
DNNIPVGPGRGSAAGSLVAYCMGITNIDPVHHGLLFERFLNPERKSMPDIDTDFCIDQRD
KVIDYVTKKYGEDRVAQIITFNRMTSKAVLKDVARVLDIPYGEADRMAKLIPVARGKPAK
LKVMISDQTPAPEFKEKYEKDARVKHWVDMALRIEGTNKTFGVHAAGVVISAVPLDEIVP
LQRNNDGQVITQYYMEDIEACGLLKMDFLGLRNLTMIQKAIDLVQETSGQAIDPDRLPMD
DPKTYQLLAKGDLEGVFQLESSGMRQIVRDLKPSNLEDISSILALYRPGPLDAGLIPKFI
NRKHGREAIDYADQMLQPILNETYGIMVYQEQIMKIAQDMGGYTLGEADLLRRAMGKKKM
SEMVKHQSTFVEGAKKNGVAEKVAAELFDQMVLFAEYCLAADTEVLTVEYGPIAIGKLVE
ENIRCQVYCCNPDGYIYSQPIGQWHQRGEQEVIEYELSDGRIIRATADHRFMTEEGEMLS
LDEIFERSLELKQIPTPLLAIAQPSPLATA
Download sequence
Identical sequences Q31L40
WP_011378362.1.45845 WP_011378362.1.95485 1140.Synpcc7942_2199 gi|81301008|ref|YP_401216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]