SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81301010|ref|YP_401218.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301010|ref|YP_401218.1|
Domain Number 1 Region: 31-266
Classification Level Classification E-value
Superfamily PLP-binding barrel 8e-67
Family Alanine racemase-like, N-terminal domain 0.0000277
Further Details:      
 
Domain Number 2 Region: 259-393
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 9.77e-49
Family Alanine racemase 0.0000788
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81301010|ref|YP_401218.1|
Sequence length 406
Comment alanine racemase [Synechococcus elongatus PCC 7942]
Sequence
MTVKPIDPQPTPRWPARRLEQLSYQRAWVEVDQGAIAANTRQIRQFLAPSCELMAVVKAD
AYGHGAVAIASTVLGAGATALGVATIPEGVRLREAGITAPILLLGSIHSPDEVQAIAHWQ
IQPSLSTPKQALICAEVLDRLGQSLPVHLKLDTGMSRLGAPWQTAVEFLQLVHGLPSLQL
ASLYSHFATADSPDRAPLQQQHAAFEQAIAQIQAEGLPVPKLHIANSAATLLDSSLHYDQ
VRVGLALYGLYPAPHLGDRLSLYPALSVKARVTHVTTLPAGQGVSYGHRYVTQRETPIAV
VGIGYADGVPRALSNQMEVLYRGQRLPQIGAITMDQMMIDISAMPQLAPGDVVTLLGRSG
SEQITADDWADRANTISWEILCGFKDRLPRFAVAADWSSNQVTVRS
Download sequence
Identical sequences Q31L38
NYSGRC-FDAO-ABB58231 WP_011378364.1.45845 WP_011378364.1.95485 gi|81301010|ref|YP_401218.1| 1140.Synpcc7942_2201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]