SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81301056|ref|YP_401264.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301056|ref|YP_401264.1|
Domain Number 1 Region: 305-605
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.31e-89
Family DNA repair protein MutS, domain III 0.00000227
Further Details:      
 
Domain Number 2 Region: 606-840
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.29e-58
Family ABC transporter ATPase domain-like 0.00000054
Further Details:      
 
Domain Number 3 Region: 140-204,235-317
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 8.24e-42
Family DNA repair protein MutS, domain II 0.00043
Further Details:      
 
Domain Number 4 Region: 25-138
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.26e-37
Family DNA repair protein MutS, domain I 0.0000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81301056|ref|YP_401264.1|
Sequence length 882
Comment DNA mismatch repair protein MutS [Synechococcus elongatus PCC 7942]
Sequence
MTTSELPEHLAKHEVRYADHRQVERDRLTPMMQHYAEVKDQHLQQILLYRMGDFFECFFQ
DAIVVARELELVLTSKEAGKEVGRVPMAGIPYHALDRYASQLVEKGYAIAICDQVETAAQ
AQGPLVRREITRIITPGTILEEGMLQARRNNFLAAVVIAGEHWGLAYADSSTGDYWTSQS
TGLEGLTQELYRLQPSEVLFPSAAPDLAGLLRPGQSKPQQIPDCLPDSFCYALRSPMPFE
LHEARQRLLEHFQLRSLEGCGCEQLPLAIRAAGGLLDYLGETQRESLAPLQKPRTYSLSE
FLILDQQTRRNLEITQTQRDGSFHGSLLWALDRTMTSMGGRLLRRWLLQPLLNPEAIRNR
QAAIQELCQDGRLRQDLRSLLQKIYDLERLSGRAGAGTANARDLLALAESLLRLPELAQL
LSRAQSPLLAQLQQVPPELEQLGDRLQQHLVESPPLQLTEGGLIRSGVAIALDELRQQVE
SDRQWIASLEASERTATGINSLKVGYSKTFGYFISLSRSKADQVPDHYIRRQTLTNEERF
ITPDLKERESRILNAQTDLNQLEYDLFVGLRSEVSHHVETIRAIATAVAAADVLAALAEV
AVYQNYCCPEIRDDRQLAIQDGRHPVVEQALPSGFYVPNSCGLGSDRGPDLIVLTGPNAS
GKSCYLRQVGLIQLLAQIGSFVPAKNAQVGICDRIFTRVGAVDDLATGQSTFMVEMNETA
NILNHATARSLVLLDEIGRGTATFDGLSIAWAVAEYLAREIQARTIFATHYHELNELSGL
LKNVANFQVTVKELPDRIVFLHQVQPGGADRSYGIEAARLAGLPSEVIDRAREVMSRIEK
HSRIAVGLRRGNGSQRRTQASPQQIDATIATEQLGLFSGPSH
Download sequence
Identical sequences Q31KZ2
WP_011378371.1.45845 WP_011378371.1.95485 gi|81301056|ref|YP_401264.1| 1140.Synpcc7942_2247 SnR206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]