SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81301141|ref|YP_401349.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301141|ref|YP_401349.1|
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.47e-41
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81301141|ref|YP_401349.1|
Sequence length 160
Comment cytochrome b6-f complex subunit IV [Synechococcus elongatus PCC 7942]
Sequence
MSILKKPDLSDPILRQKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTIACLTGLAVLDPA
LVGEPADPFATPLEILPEWYLYPVFQILRIVPNKLLGIVLQSMIPLGLIAIPFIESVNKF
QNPFRRPIATAVFLFGTVFTLYLGIGAALPIDKSLTLGLF
Download sequence
Identical sequences Q54710 Q5N160
1140.Synpcc7942_2332 269084.syc1770_c WP_011244080.1.45845 WP_011244080.1.5740 WP_011244080.1.95485 gi|81301141|ref|YP_401349.1| gi|56751779|ref|YP_172480.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]