SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81301202|ref|YP_401410.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301202|ref|YP_401410.1|
Domain Number 1 Region: 3-310
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.23e-108
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000015
Further Details:      
 
Domain Number 2 Region: 312-476
Classification Level Classification E-value
Superfamily An anticodon-binding domain of class I aminoacyl-tRNA synthetases 1.83e-32
Family C-terminal domain of glutamyl-tRNA synthetase (GluRS) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81301202|ref|YP_401410.1|
Sequence length 481
Comment glutamyl-tRNA synthetase [Synechococcus elongatus PCC 7942]
Sequence
MSVRVRIAPSPTGNLHIGTARTAVFNWLFARRHQGQFILRIEDTDLERSRSEYTDNILTG
LQWLGLNWDEGPFYQTQRLDLYKAAVQQLLDSGKAYRCYCTEAELEALRESQRARNEAPR
YDNRHRDLTPEQEAAFQAEGREAVIRFRIDDDREIAWTDLVRDRVVWKGSDLGGDMVIAR
RSPAGTIGQPLYNLAVVVDDIDMTISHVIRGEDHIANTAKQILLYEALGAAVPEFAHTPL
ILNKEGRKLSKRDGVTSISDFQNLGYLPEAIANYMTLLGWSPVEGMDERFSLAEAATVFD
FDRVNKAGAKFDWDKLNWLNSQVIKEKSASELVALLQPFWSKAGVDTAAYPAAWLEELAT
LLGPSLVTLTDIVGQSQLFFSQGIELQEDAIAQLGQAGSKAVLQQILEALPSEALTLEVA
KGLIDQAVKAAGVKKGIGMRSLRAALMGSMQGPDLLTSWVLLHQAGQAQPRLQAAIAAAQ
G
Download sequence
Identical sequences Q5N1B8 Q8L1E5
gi|81301202|ref|YP_401410.1| gi|56751721|ref|YP_172422.1| 1140.Synpcc7942_2393 269084.syc1712_c WP_011244022.1.45845 WP_011244022.1.5740 WP_011244022.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]