SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81301230|ref|YP_401438.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|81301230|ref|YP_401438.1|
Domain Number - Region: 41-152
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0275
Family Clc chloride channel 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81301230|ref|YP_401438.1|
Sequence length 305
Comment high-affinity iron transporter [Synechococcus elongatus PCC 7942]
Sequence
MNWTTALPSFLITLREGFEAALVVGIVLACLAKADRPDLKRWVYLGLLAGLLASLLLGLL
LGNALGTLSAAQFYYAPALRLLLEALLCAIAVGLLSWMLIWMTQQSRSLKSEVEQGIQQA
IRAGSDRAVFGIVFAAVLREGFETVIFLLTQGQRGWLPSLGAIAGLSGAGLLGWAIFRGS
IRLNLRRFFQVMGVLLLVITGGLLLTALRKLDGGLGLLNQLSQGRWGLCQSAASCVLGPQ
LWDLQAVLPDRQFPGLFLKLIAGYSDRLFLIPAIAYIIFWIGVGGLYFRSLRSPQPTKTP
APQES
Download sequence
Identical sequences A0A0H3K497 Q31KG8
gi|81301230|ref|YP_401438.1| WP_011243995.1.45845 WP_011243995.1.5740 WP_011243995.1.95485 1140.Synpcc7942_2421 269084.syc1685_d gi|56751694|ref|YP_172395.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]