SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81301282|ref|YP_401490.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301282|ref|YP_401490.1|
Domain Number 1 Region: 41-221
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000589
Family GAF domain 0.011
Further Details:      
 
Domain Number 2 Region: 241-460
Classification Level Classification E-value
Superfamily PP2C-like 0.000000471
Family PP2C-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81301282|ref|YP_401490.1|
Sequence length 462
Comment serine phosphatase [Synechococcus elongatus PCC 7942]
Sequence
MTTLPYFQPAASPASAGEGSASLSPVIALKDLVARLDREQRKAQELLASLGFALRSFTNL
GQFLELIPLIASRVTDTEGSLLLTFRPDGRFWQAQLHCTDPRLAETLNRIPASLPVGTAP
SGSPTEAIAEIDRQVQRCLGRNAQLFATAVLVRNQARGRLYVFSLDGQYSWNESRQKLVR
LVADQTAVAIENDALTTELRQKERLDRELEIGAEIQLQLLPSQCPAIEGLEIAAACRTAS
RVGGDYYDFIPTRTHSDEQGRLQPDAGSPWAIAIGDIMGKGVPAGLIMTMLRGMLRAEVL
NRHRPSRVLAHLNQVIYADLEHSNRFATLFYSEYDPSSRLLTFSNAAHNPPLLWQQATGT
LKRLDTFGMMIGLEADNAYAEQHVQLQPGDVVLYYTDGLTDAADPRGNRFDEENVAIAFR
EACRRRLSAEALLADLFNRVQRFIGPDRHNEDDMTLVVLRAV
Download sequence
Identical sequences A0A0H3K3F9 Q8GIR9
1140.Synpcc7942_2473 269084.syc1631_c gi|81301282|ref|YP_401490.1| 368470 gi|56751640|ref|YP_172341.1| WP_011243941.1.5740 WP_011243941.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]