SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81301335|ref|YP_401543.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301335|ref|YP_401543.1|
Domain Number 1 Region: 84-430
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.01e-72
Family Extended AAA-ATPase domain 0.0000000113
Further Details:      
 
Domain Number 2 Region: 8-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000171
Family ClpX chaperone zinc binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81301335|ref|YP_401543.1|
Sequence length 449
Comment ATP-dependent protease ATP-binding subunit ClpX [Synechococcus elongatus PCC 7942]
Sequence
MSRYDSHLKCSFCGKSQEQVRKLIAGPGVYICDECVDLCNEILDEELFDGNANPAPPPGS
PKPATAATTSHQGPRKPKRSLTLSQIPKPHDIKRYLDHHVIGQNEAKKMLSVAVYNHYKR
LAYQQSAEEAGETIEIQKSNILLIGPTGCGKTLLAQTLAKLLDVPFAVADATTLTEAGYV
GEDVENILLRLLQVADLDIEEAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKM
LEGTIANVPPQGGRKHPYQDCIQIDTRNILFICGGAFVGLEKLVDRRLGKKSIGFVHPEE
SKTKEQRAAAILRHMEPEDLVQFGLIPEFIGRMPVTAVLDPLDETALTEILTEPRDALVK
QYQKLMHMDSVELEFRQDAIEAIAREAFRRKTGARALRGIVEEIMLEVMYELPSRQDVTH
CTITREMVEKRSSADVLLLPSSLPTPESA
Download sequence
Identical sequences O34126 Q5N1P7
WP_011243893.1.45845 WP_011243893.1.5740 WP_011243893.1.95485 gi|56751592|ref|YP_172293.1| 1140.Synpcc7942_2526 269084.syc1583_c gi|81301335|ref|YP_401543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]