SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81298838|ref|YP_399046.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81298838|ref|YP_399046.1|
Domain Number 1 Region: 12-385
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.17e-101
Family GABA-aminotransferase-like 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81298838|ref|YP_399046.1|
Sequence length 388
Comment 8-amino-7-oxononanoate synthase [Synechococcus elongatus PCC 7942]
Sequence
MVSDRGVAKWAFVEEAFQKRGPSNRRSLREFSPEAGPYLRQGDRPLLDFSSNDYLGLAQD
PRLIAAATAAMRRYGTGAMASRLVCGSFPLHQQLEEALAAFSQREAALLFSSGYQANATL
LPTLFDRQSLVLVDRLAHNSLLFGVQASKAQWRRYRHNDFDHLEQLLQQAPAGVRLGIVS
ETVFSMDGDRTDVDRLADLADRYGAILYLDDAHALGVLGTEGSGLALRHPRVDVAVGTFG
KACGSAGAFVVASRSLCDYWINTCPGLIYTTAIAPPVVAAALAAVQLLPELEPERQHLQA
IAAELRQSCRDRGWDCGPSETQIVPLLVGESEQALALAQRLEAAGILAIAIRPPTVPEGT
ARLRLVLRSDHQPQHLHQLVTVLSEGWV
Download sequence
Identical sequences A0A0H3K680 Q31SB0
WP_011243780.1.45845 WP_011243780.1.5740 WP_011243780.1.95485 gi|81298838|ref|YP_399046.1| 1140.Synpcc7942_0027 269084.syc1470_c gi|56751479|ref|YP_172180.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]