SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81298867|ref|YP_399075.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81298867|ref|YP_399075.1|
Domain Number 1 Region: 8-370
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.68e-105
Family GABA-aminotransferase-like 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81298867|ref|YP_399075.1|
Sequence length 375
Comment perosamine synthetase [Synechococcus elongatus PCC 7942]
Sequence
MAKQSYRKIPYTKPSITELEIQYATDAARNGWGEHCYDYIIRFEEAFKQHLGVQYAIATS
SCTGALHMGMHALGIGPGDEVILADTNWIATAAPIIHLGAIPVFVDILPDSWCLDPEQVQ
AAITPKTKAIIAVHLYGNLCEMDALLAIGERYSIPVIEDAAEAIGSVYHGKRAGSMGRFG
AFSFHGTKTITTGEGGMFVTNDPELYEHVLTLSNHGRARGQTKQFWPDMVGFKYKMSNIQ
AAIGYAQMQRIEILIHMKRKIFSMYQNYLKDLPVQMNHEPRGCTNGYWMPTFVVNEKVSF
NRNKLISKLKSNGVDARVFFWPLSSTSTGGRKALDKPYLSESIHLHALNLPSHYQLSNEE
SMFICTLIKNTSFSG
Download sequence
Identical sequences Q31S81
1140.Synpcc7942_0056 WP_011377422.1.45845 WP_011377422.1.95485 gi|81298867|ref|YP_399075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]