SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81298882|ref|YP_399090.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81298882|ref|YP_399090.1|
Domain Number 1 Region: 22-391
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.48e-117
Family GABA-aminotransferase-like 0.00000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81298882|ref|YP_399090.1|
Sequence length 399
Comment pleiotropic regulatory protein-like protein [Synechococcus elongatus PCC 7942]
Sequence
MCSSSECPVTSIPAFNLTEQYRRIGAELETATAKVLASGGYIGGQTVADFEAAFAAAMGV
TEAVGCNSGTDALHLALRALDIGPGDEVITSPFTFFASAEAISLAGATPVLVDIEPQFFN
LDYRQIEAAITPRTKAIIPVHLFGHPAAMSEIMAIARAHNLRVIEDCAQATGATWQGQPV
GSFGDCGCFSFYPTKNLGACGDGGLVTTKNPEVADRLRSLRQHGMRVRYYHDEIGLNSRL
DALQAVILSIKLRYLDEWNQQRQAIAQRYGEAIAAIPGLVAPSVHADAVHVWHQYTVRVQ
ACGDRSRCVSHPCDRQGLCRDWLQQQLQAQGIGSMIYYPVPVHLQQAYSQLGYKTGDFPE
AERAAQEVLSLPMFPELNEDDQARVITALKDLAIAAVQS
Download sequence
Identical sequences A0A0H3K324 Q31S66
1140.Synpcc7942_0071 269084.syc1433_d gi|56751442|ref|YP_172143.1| gi|81298882|ref|YP_399090.1| WP_011243745.1.45845 WP_011243745.1.5740 WP_011243745.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]