SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299002|ref|YP_399210.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299002|ref|YP_399210.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.17e-104
Family Cystathionine synthase-like 0.00000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299002|ref|YP_399210.1|
Sequence length 382
Comment Serine--glyoxylate transaminase [Synechococcus elongatus PCC 7942]
Sequence
MEDKLMLMIPGPTPVPEQVLLAMAKHPIGHRSADFSRLVADTTAGLKWLHQTTGNVLVLC
SSGTGAMEAGIINFLSAGDRVLCCENGKFGERWVKLAQAFGLDVDLVQAPWGKPLDPEAI
RAKLEADTDKQIKAVILTHSETSTGVINDLETISGYIRAHGALSIVDAVTSLGAANVPID
AWGLDVVASGSQKGYMIPPGLGFVAVSDRAWKAYETATLPKFYLDLGKYRKAAQKDSNPF
TPPVNLYYALDAALKIMQREGLENIFARHAKLTRATRAAIKALNLPLYAADEVGSPAITA
VAPVEVAAEDIRSFTKKHFDILLAGGQDDLKGKIFRIGHLGFVSGRDVLTAIAAIEAALT
GLGYSNFTSGAGVAAAAAELAK
Download sequence
Identical sequences A0A0H3K2P4 Q31RU6
WP_011243632.1.45845 WP_011243632.1.5740 WP_011243632.1.95485 gi|81299002|ref|YP_399210.1| gi|56751329|ref|YP_172030.1| 1140.Synpcc7942_0191 269084.syc1320_c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]