SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299181|ref|YP_399389.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299181|ref|YP_399389.1|
Domain Number 1 Region: 4-428
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.33e-126
Family Cystathionine synthase-like 0.00000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299181|ref|YP_399389.1|
Sequence length 434
Comment O-acetylhomoserine/O-acetylserine sulfhydrylase [Synechococcus elongatus PCC 7942]
Sequence
MSQHLETLALHAGQKPDPTTGSRAVPIYQTTSYVFEDAEHAANLFALKAFGNIYTRLMNP
TTDVLEQRLAALHGGTGAVATSSGQAAIFYAIAAITSAGQNIISTTNLYGGTINLFRHTL
KRFGIEVRFVDSSDASSVAAAIDENTRLVYTESIGNPKGNVDDFEAIAAIAHDSGIPFIV
DNTVSPPPLFNPLEHGADVVVLSLTKLAGGHGTSLGGIVIEKGDFPWNNGKFPEIAGPDP
SYHGVNFWDAFGNHPEAVAPGLAYVLKIRTGLLRDIGATLSPFNAQQVLLGVETLPLRAE
RHVRNAQAVAEWLERHPLVTWVNYPGLPSHPDYDRAQRYLPNGAGAILGFGVQGGLEAGK
RFISAVKLASNLANVLDAKTLVIHPASTTHQQLSPEEQAAAGVSPDFVRLSVGLEHLDDI
LADLDQALQASQVA
Download sequence
Identical sequences A0A0H3K8M4 Q31RB7
gi|56751152|ref|YP_171853.1| gi|81299181|ref|YP_399389.1| WP_011243455.1.45845 WP_011243455.1.5740 WP_011243455.1.95485 1140.Synpcc7942_0370 269084.syc1143_c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]