SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299456|ref|YP_399664.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299456|ref|YP_399664.1|
Domain Number 1 Region: 29-451
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.5e-134
Family GABA-aminotransferase-like 0.000000000000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299456|ref|YP_399664.1|
Sequence length 453
Comment glutamate-1-semialdehyde aminotransferase [Synechococcus elongatus PCC 7942]
Sequence
MRRLSASLAGDARLVCEEIALVTSSPFKTIKSDEIFAAAQKLMPGGVSSPVRAFKSVGGQ
PIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEALKVAMEKGTSFGAPCALE
NVLAEMVIDAVPSIEMVRFVNSGTEACMAVLRLMRAYTGRDKIIKFEGCYHGHADMFLVK
AGSGVATLGLPDSPGVPKSTTANTLTAPYNDLEAVKALFAENPGEIAGVILEPIVGNSGF
IVPDAGFLEGLREITLEHDALLVFDEVMTGFRIAYGGVQEKFGVTPDLTTLGKIIGGGLP
VGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLS
DGLLAIAQETGHAACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYL
APSQFEAGFTSLAHTEEDIDATLAAARTVMSAL
Download sequence
Identical sequences 1140.Synpcc7942_0645 gi|81299456|ref|YP_399664.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]