SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299518|ref|YP_399726.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299518|ref|YP_399726.1|
Domain Number 1 Region: 4-381
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.08e-88
Family GABA-aminotransferase-like 0.017
Further Details:      
 
Domain Number 2 Region: 338-485
Classification Level Classification E-value
Superfamily Ornithine decarboxylase C-terminal domain 4.71e-36
Family Ornithine decarboxylase C-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299518|ref|YP_399726.1|
Sequence length 489
Comment arginine decarboxylase [Synechococcus elongatus PCC 7942]
Sequence
MAKPLFDQLLASAQQARAPFHTPGHKLGRAIATHLQQAWGSAIFQSDLPELPELDNLYAA
SGVLAESQAQAAEVFGADRSWFLVNGSTGGLLAAILTICSPGDRLLLPRNAHRSLLSGCI
LSGAMPVWITPPEAADFDLVGVPTPEQVATALAQDPQIKAVVLVSPTYEGVCADVAAIAA
IAHNHNLPLIIDAAHGAHLGFHPDLPRSPLHEGADLVVQSTHKLLGALTQAAMLHCKGDR
IDPERLSQSLALVQSSSPSYLLLASLEAATEQMRTSAQDLLQVTIDLARQAHQRLAELPG
LQLPALKIGNREGFPQWDRTRLVINFQSCGWSGFCADEYLHEQWQVTAELPSLSNLVFHL
SLGNRIEDIDRLVTACDRLLSQEHQEELPPRLPVWLEPETILSPRQAWFSRHQTVSAEQA
IGAIAAECVCPYPPGIPVLLPGERISKSAVDYLRQVQTTGGILSGCADPELTTLRIVQDS
DTIHASCLS
Download sequence
Identical sequences Q31QD0
1140.Synpcc7942_0707 gi|81299518|ref|YP_399726.1| 391511 WP_011377691.1.45845 WP_011377691.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]