SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299662|ref|YP_399870.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299662|ref|YP_399870.1|
Domain Number 1 Region: 3-408
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.86e-79
Family AAT-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299662|ref|YP_399870.1|
Sequence length 411
Comment L,L-diaminopimelate aminotransferase [Synechococcus elongatus PCC 7942]
Sequence
MATINDNYLKLKAGYLFPEIARRVNAFAQSNPEAAIIRLGIGDVTEPLPVACRQAMIQAV
EDMGQRENFKGYGPEQGYAWLREKIAAHDFQSRGCEVDASEIFISDGSKCDCGNILDIFG
NNNRIAVTDPVYPVYVDTNVMAGHTGDANDRGEYDGLVYLPISAENNFTAEIPSEKVDLI
YLCFPNNPTGAVASREYLQAWVDYARANGAIILFDAAYEAFITDPAIPHSIFEIPGARDC
AIEFRSFSKNAGFTGTRCAFTVVPKGLKGKAADGSEVELWGLWNRRQSTKFNGVSYIVQR
GAEAVYSAEGQAQIKELVAFYLENARIIREELTAAGLDVHGGVNAPYVWVKTPAGLTSWD
FFDKLLQVCNVVGTPGSGFGAAGEGYFRISAFNSRENVVTAMQRIRSAGLA
Download sequence
Identical sequences Q31PY6 Q5N492
gi|56750696|ref|YP_171397.1| gi|81299662|ref|YP_399870.1| 1140.Synpcc7942_0853 269084.syc0687_c WP_011242999.1.45845 WP_011242999.1.5740 WP_011242999.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]