SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299839|ref|YP_400047.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299839|ref|YP_400047.1|
Domain Number 1 Region: 29-361
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.59e-61
Family AAT-like 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299839|ref|YP_400047.1|
Sequence length 373
Comment histidinol-phosphate aminotransferase [Synechococcus elongatus PCC 7942]
Sequence
MLPFLRSELARCQPYHPNPGGTGMAMDILDTNECPYDLPTDLKQTLADRYVEAIASNRYP
DGSHTDLKAAIVDYLSEQTAGQWQPGPEHVTVGNGSDELIRSILIATCLGGQGSVLVAEP
TFSMYGIVAETLGIPVVRIGRDPQTWEMDLAAAETAITQTEGTPVRLCFVVHPNSPTANP
LTEAEKDWLRQVPPQILVVIDEAYFEFSGETLLAELPQHPNWLITRTFSKALRLAAHRVG
YGIGDPQLIAALEAIRLPYNLPSVAQLAATLALEARSQLLSAIPRLITERDRLYRKLQVV
SQLQVWPSASNFLFLKTQSSSQTAALAAQLKAQGTLVRHTADGLRITIGSPAENERTLAH
LQTAITQSLPATV
Download sequence
Identical sequences Q31PF9
391512 WP_011377834.1.45845 WP_011377834.1.95485 1140.Synpcc7942_1030 gi|81299839|ref|YP_400047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]