SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300064|ref|YP_400272.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300064|ref|YP_400272.1|
Domain Number 1 Region: 9-387
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.28e-81
Family Cystathionine synthase-like 0.0000000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81300064|ref|YP_400272.1|
Sequence length 387
Comment L-cysteine/cystine lyase [Synechococcus elongatus PCC 7942]
Sequence
MTRDRLLTHRQQFPALQNKAYFNYGGQGPLSTAALTAIQTAFADSQQLGPFSLATGQRVE
QISDRLRTDLAALLQTQSENITLTENVSVGCNIALWGVDWQAGDRLLITDCEHPSVIATA
QAIAQRFGVELDIWPLQAAVVAGQDLTEAFAAQLNSRTRLAAISHVLWNYGTVLPLAAIA
EQAHRQDCLLLVDGAQSVGLLPLDLPATGVDFYAFTGHKWLCGPEGVGGLYSRPESRATS
LPTWLGWRGVEKNTQGRPIRSKSDGRRYEIATSAYPLYAGLSAAIAQQADYGTIEDRYNR
SRQLAQWLWQSLQALPKVRCLATTLPQAGLISFQIDSSQSPFKIVSHLEGQGLQIRSLVG
PDCLRACCHYLTLETELESLVAAIAQI
Download sequence
Identical sequences A0A0H3K0B6 Q31NT4
1140.Synpcc7942_1255 269084.syc0296_d gi|56750305|ref|YP_171006.1| WP_011242610.1.45845 WP_011242610.1.5740 WP_011242610.1.95485 gi|81300064|ref|YP_400272.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]