SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300547|ref|YP_400755.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300547|ref|YP_400755.1|
Domain Number 1 Region: 12-412
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.09e-128
Family Cystathionine synthase-like 0.000000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300547|ref|YP_400755.1|
Sequence length 419
Comment cysteine desulfurase [Synechococcus elongatus PCC 7942]
Sequence
MTAIALTNLATEVRADFPILQQQVNGQPLVYLDNAATSQKPRAVIQSLVDYYEGYNSNVH
RGVHTLSGKATDAYEGARQKVARFINAKTEQEIVYTRNASEAINLVAYSFGMNFLQAGDE
IILSAMEHHSNLIPWQFVAAKTGAALKFVGVTETGQFDLEQFRSLLSDRTKLVSVVHVSN
TLGCCNPVTEICQLAHAKGARVLIDACQSLPHQAIDVQAIDCDWLVGSGHKMCAPTGIGF
LYGKLDLLRQMPPFLGGGEMIADVFLDHATYADLPHKFEAGTPAIGEAIALGAAIDYLTA
IGMDRIHAYEQQLTQHLFQRLAEIPELTVYGPTPEQDRDRAALAAFTAGAVHPHDLSTIL
DQSGIAIRAGHHCTQPLHRELQVQSTARASCYFYNTTDEIDRLIESLKEAVEFFGAIFS
Download sequence
Identical sequences A0A0H3K975 Q31MF1
WP_011244663.1.45845 WP_011244663.1.5740 WP_011244663.1.95485 gi|56752362|ref|YP_173063.1| 1140.Synpcc7942_1738 269084.syc2353_c gi|81300547|ref|YP_400755.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]