SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300738|ref|YP_400946.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300738|ref|YP_400946.1|
Domain Number 1 Region: 3-374
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.86e-92
Family Cystathionine synthase-like 0.00000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300738|ref|YP_400946.1|
Sequence length 386
Comment cysteine desulfurase [Synechococcus elongatus PCC 7942]
Sequence
MSTYLDYSATTSMRPEVLERFTAVAQEQWGNAASLHQWGNRAALVLERSRQQVAALIQAE
PEAIAFSSGGTESDNWAILSPYLADPRPGHLIISAVEHSAIARPAAWLEQRGWQVTRLPV
DRSGRIQPADLASAVRPDTRLISVIWGQSEVGTIQPIAELAAIAREHGILFHTDAVQVAG
RLPIDVQRLPIDLLSLSSHKLYGPQGVGALYIRPGVELAPLLQGGNQESGLRSGTPPIAA
IAAFGEAAQLAAAELPHETARLQSLRDRLIAVLATEPRLRLTGDPIQRLPHHASFIARGG
TTGTSQQLVRAMNRLGFGISGGSACNSGRSQPSPVLLAMGYSPQEALAGIRFSLGRSTQL
AEVEAAAIALRSALHSLPQASLLSPA
Download sequence
Identical sequences A0A0H3K589 Q31LW0
gi|81300738|ref|YP_400946.1| gi|56752174|ref|YP_172875.1| 1140.Synpcc7942_1929 269084.syc2165_c WP_011244475.1.45845 WP_011244475.1.5740 WP_011244475.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]