SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300856|ref|YP_401064.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300856|ref|YP_401064.1|
Domain Number 1 Region: 11-435
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.27e-102
Family Glycine dehydrogenase subunits (GDC-P) 0.00000132
Further Details:      
 
Domain Number 2 Region: 467-880,923-945
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.94e-97
Family Glycine dehydrogenase subunits (GDC-P) 0.0000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81300856|ref|YP_401064.1|
Sequence length 953
Comment glycine dehydrogenase [Synechococcus elongatus PCC 7942]
Sequence
MSASPHNFAQRHLGPRPADVEQMLQKLGCESLEDLLAAVVPADIRLPRSLNLPEPCSEAE
ALAELRAIAHQNQILRSYLGQGYANCLTPPVIQRNILENPGWYTAYTPYQAEIAQGRLEA
LLNFQTMVSDLTGLEIANASLLDEATAAAEAMTLSLAVAKSKSQTYFVAHNCHPQTIAVV
QTRAAALGIEVLVADLLQFDFQTPIFGLLLQYPATDGTIADYRSVIEQAHAQGAIATVAC
DLLALTLLTPPGEFGADIAVGNSQRFGVPLGYGGPHAAFFATKEAYKRQIPGRIVGVSKD
AQGQPALRLALQTREQHIRRDKATSNICTAQVLLAVVAGFYAVYHGAEGLTAIARQVRRQ
TQILAEELQSLGFKIPQQPGFDTLIVEVEDPKVWQSRTEAAGFNLRCLSDRQLGISLDET
TTDSDLLDLLTVFAQGRSLPAWEDLQAAVTDEVDPAFARQTPFLTHPVFQQYHSETELLR
YIHRLQSRDLSLTTAMIPLGSCTMKLNATAEMLPISWPEFNQIHPFAPLSQTQGYQQLFQ
QLESWLAEITGFAAVSLQPNAGSQGEYAGLLVIQRYHQSRGEDHRQICLIPQSAHGTNPA
SAVMAGMKVVPIACDDRGNIDVSDLQQKAAQYADQLAALMVTYPSTHGVFEEAIAEICAI
VHQQGGQVYLDGANLNAQVGLCQPAQFGADVCHLNLHKTFCIPHGGGGPGVGPIGVAAHL
APFLPSHPLVPEANADPQALGPIAAAPWGSASILPISWMYIRMMGAAGLTQASAIAILNA
NYIATRLAPYYPILYRGDRGFVAHECILDLRPLKRTAGIEVEDVAKRLMDYGFHAPTMSW
PVLGTLMVEPTESESLAELDRFCEAMIGIYHEVDAIASGDLDPLDNPLKHAPHPADVLLQ
SDWNRAYSREQAAYPAPWTREHKFWPVVSRIDNAYGDRNLVCSCLPMSAYSDR
Download sequence
Identical sequences A0A0H3K4C9 Q31LJ2
1140.Synpcc7942_2047 269084.syc2046_c gi|56752055|ref|YP_172756.1| WP_011244356.1.45845 WP_011244356.1.5740 WP_011244356.1.95485 gi|81300856|ref|YP_401064.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]