SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81300969|ref|YP_401177.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81300969|ref|YP_401177.1|
Domain Number 1 Region: 22-381
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.42e-106
Family Cystathionine synthase-like 0.000000000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81300969|ref|YP_401177.1|
Sequence length 384
Comment alanine-glyoxylate aminotransferase [Synechococcus elongatus PCC 7942]
Sequence
MTVTLPSVSEKHRVRLQPLELPERLLLGPGPSNAHPAVLEAISRPPIGHLDPKFLELMTE
VQGLLRYIWQTDNRLTIPVSGTGSAAMEATIANSVEPGDVVLVGVMGYFGNRLVDMAGRY
GADVRTIHKPWGDVFSLAELRQALEEHRPQILALVHAETSTGAEQPLAGVGDLCREFDCL
LLIDTVTSLGAVPTLLDEWGVDLAYSCSQKGLSCPPGVSPFTMGPRAEEKLARRKGKVAN
WYLDMSLLNQYWGSDRVYHHTAPVNMNFGIREALRLIADEGIETVWKRHRDNAEYLWAGL
EDLGLTCHVPVENRLPTLTTVRIPEGVDGKAVSRQLLDEHGIEMGGGLGELAGKVWRIGL
MGYNSRRENVDRLLSILADVLPRS
Download sequence
Identical sequences Q31L79
WP_011378346.1.45845 WP_011378346.1.5740 WP_011378346.1.95485 1140.Synpcc7942_2160 gi|81300969|ref|YP_401177.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]