SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81301067|ref|YP_401275.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301067|ref|YP_401275.1|
Domain Number 1 Region: 28-419
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.31e-67
Family AAT-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81301067|ref|YP_401275.1|
Sequence length 427
Comment valine--pyruvate transaminase [Synechococcus elongatus PCC 7942]
Sequence
MSLESLSRYGRQMSQLTGVRAIMKDIIETLRSGQGQTFINLSAGNPVVLPEVEQLWRDCT
ADLLGSAEYGQVVGRYGTSQGYEPLIAAIIQEFNQRYGWSISDRNILITPGSQSLYFLAA
NAFGGWAEDGSLRKILLPLSPDYTGYGGVCLEPQAVVAARPQIERIGDHRFKYRPDFEQL
QIGADTGMLLFSRPCNPTGNVISDAELERLATLAAAQNVPVFVDSAYAPPFPGLNFTEMT
PFFGDNIVHCLSLSKAGLPGERLGIAIGPEPVIQVLEAFQTNLCIHSSRYGQAIAARAIA
SGQLTAIAETVIRPYYAAKFARVERQLDALLPDSLPWRLHQGEGGIFAWLWLEEAPLDDW
QIYQQLKQAGVIVVPGSSFFPGLREDWVHTRQCLRISLAAEDHELETGMERLATTVQQIY
RQAPIPA
Download sequence
Identical sequences A0A0H3K3W2 Q31KY1
gi|81301067|ref|YP_401275.1| WP_011244150.1.95485 1140.Synpcc7942_2258 269084.syc1840_c gi|56751849|ref|YP_172550.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]