SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81301354|ref|YP_401562.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81301354|ref|YP_401562.1|
Domain Number 1 Region: 1-383
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.67e-119
Family AAT-like 0.00000000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81301354|ref|YP_401562.1|
Sequence length 392
Comment aspartate aminotransferase [Synechococcus elongatus PCC 7942]
Sequence
MKLSERVGRVSPSLTLAIAAQAKAMKAEGLDVCSFSAGEPDFETPLHIRNAAAQALAEGK
TRYGPAAGEPDLREAIAQKLRADNGLDYQAANILVTNGGKQSLYNLMQVLLDPGDEVIIP
APYWLSYPEMVKLAGGVPVIVETFASDGFKLQPQQLAGAITPRTRLLVLNSPSNPTGMVY
SRQELEAIAPIIEAHDFWVVSDEIYEKILYDGADHHSIGSLSPACFERTLISNGFAKAYS
MTGWRVGYLAGPSELIAAAASLQSHSTSNVCTFAQYGAIAALQGPQDCVAEMLAAFTERR
QLILNGLNQIAGLSCPIPEGAFYVFVDISKTGLDSMTYCRQLLDQHQVAAIPGIAFGDDR
SIRLSYATDCQTIEKGLERLQLFQNSLLGVSV
Download sequence
Identical sequences A0A0H3KA26 Q31K44
gi|81301354|ref|YP_401562.1| gi|56751574|ref|YP_172275.1| WP_011243875.1.45845 WP_011243875.1.5740 WP_011243875.1.95485 1140.Synpcc7942_2545 269084.syc1565_c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]