SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161761306|ref|YP_060741.2| from Streptococcus pyogenes MGAS10394

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161761306|ref|YP_060741.2|
Domain Number 1 Region: 6-326
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.84e-118
Family TK-like PP module 0.0000000329
Further Details:      
 
Domain Number 2 Region: 343-524
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-64
Family TK-like Pyr module 0.00000727
Further Details:      
 
Domain Number 3 Region: 533-660
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 7.72e-38
Family Transketolase C-terminal domain-like 0.0000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161761306|ref|YP_060741.2|
Sequence length 661
Comment transketolase [Streptococcus pyogenes MGAS10394]
Sequence
MTFDAIDQLAVNTVRTLSMDAIQAANSGHPGLPMGAAPMAYVLWNHFMNINPKTSRNWSN
RDRFILSAGHGSAMLYSLLHLAGYDLSVEDLKNFRQWGSKTPGHPEVNHTDGVEATTGPL
GQGIANAVGMAMAEAHLAAKFNKPGFDIVDHYTFALNGDGDLMEGVSQEAASMAGHLKLG
KLVLLYDSNDISLDGPTSMAFTEDVKGRFEAYGWQHILVKDGNDLEEIAAAIEAAKAETE
KPTIIEVKTIIGFGAEKQGTSAVHGAPLGAEGIAFAKKAYQWTHQDFEVPAEVTERFAQG
LQARGEKAEQAWNDLFAAYEAEYPELAAEYQKAFANEAAQVELEAHELGSSMASRVSSQQ
AIQQISEQVASFWGGSADLSASNNTMVKAETDFQPGHYEGRNVWFGVREFAMAAAMNGIA
LHGGTRVYGGTFFVFSNYLLPAVRMAALQNLPTVYVMTHDSIAVGEDGPTHEPIEQLASV
RSMPNLNVIRPADGNETNAAWKRAIAETDRPTMLVLTRQNLPVLEGTKELAEDGLNKGAY
ILSEAKGDLEGILIATGSEVKLAMDTQEALEAEGIHVRVVSMPSQNIFDEQSAEYKESIL
PAAVTKRLAIEAGSSFGWAKYVGLAGKTLTIDTWGASAPGNRIFEEYGFTVANATELYKS
L
Download sequence
Identical sequences WP_011184842.1.22309 WP_011184842.1.2644 WP_011184842.1.30259 WP_011184842.1.32327 WP_011184842.1.84548 286636.M6_Spy1423 gi|161761306|ref|YP_060741.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]