SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50913677|ref|YP_059649.1| from Streptococcus pyogenes MGAS10394

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50913677|ref|YP_059649.1|
Domain Number 1 Region: 4-171
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.8e-46
Family YfcE-like 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|50913677|ref|YP_059649.1|
Sequence length 173
Comment phosphoesterase [Streptococcus pyogenes MGAS10394]
Sequence
MASKTIIVMSDSHGDRDIVQAIKDKYLGQVDAIFHNGDSELNSSDPIWAGIYVVGGNCDY
DTGYPDRLVTQLGTVTIAQTHGHLYHINFTWDKLDYFAQEVAADICLYGHLHRPAAWQVG
QILFMNPGSVTQPRGEINEKLYARVELTDTQIKVDYFTRDHKLYPSLSKEFKR
Download sequence
Identical sequences Q5XDP7
gi|50913677|ref|YP_059649.1| WP_011184198.1.22309 WP_011184198.1.2644 WP_011184198.1.30259 WP_011184198.1.32327 WP_011184198.1.84548 286636.M6_Spy0331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]