SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50913995|ref|YP_059967.1| from Streptococcus pyogenes MGAS10394

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50913995|ref|YP_059967.1|
Domain Number 1 Region: 86-338
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.14e-41
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|50913995|ref|YP_059967.1|
Sequence length 430
Comment capsule biosynthesis protein [Streptococcus pyogenes MGAS10394]
Sequence
MILLKSLYKGFFAAMKEENFEARCYNREKGGCVLIKTIPYKKTMAAVVALIVALLLFGLI
YDLLGVQKNKLAAQKSAQPKVKTARVVANGDILIHDILYMSARKADDTYDFTPYFEYVKD
WISGADLAIGDYEGTISPDYPLAGYPLFNAPEEIAGALKNTGYDVVDLAHNHILDSQLDG
ALNTKKVFHQLGIDSIGIYDKDRSKESFLIKNVNGIKIAILGYSYGYNGMEATLSQEDYE
KHMSDLDEAKIKKELQLAEKKADVTIVMPQMGTEYALEPTAEQKELYHKMIDWGADVVLG
GHPHVIEPSETVIKGRQKKFIIYSMGNFISNQRLETVDDIWTERGLLMDLTFEKKVNKTK
IKTVEAHPTMVLAKGKGIVGKEGFELYNYRTMVLEDFIKGGKYHDKIDEETKAKVALAYQ
EINDLVNLKW
Download sequence
Identical sequences Q5XCS9
286636.M6_Spy0649 WP_011184384.1.22309 WP_011184384.1.2644 WP_011184384.1.30259 WP_011184384.1.32327 WP_011184384.1.84548 gi|50913995|ref|YP_059967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]